SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325979194|ref|YP_004288910.1| from Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325979194|ref|YP_004288910.1|
Domain Number 1 Region: 301-591
Classification Level Classification E-value
Superfamily HAD-like 6.42e-47
Family Meta-cation ATPase, catalytic domain P 0.001
Further Details:      
 
Domain Number 2 Region: 113-210
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.19e-21
Family Calcium ATPase, transduction domain A 0.0077
Further Details:      
 
Domain Number 3 Region: 65-114,211-297
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000112
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325979194|ref|YP_004288910.1|
Sequence length 598
Comment cadmium-translocating P-type ATPase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
Sequence
MSNFKKLLAIITIALLALIINFVFHKPDLAYILVVIFCGIISLSMLIDMIKTLKSGQYGV
DILAISAIIVTLLVGDYWASLMILIMLTGGESLEDYASKQASRELRSLLDNSPQIAHRLV
GHELEDVPVEALKIDDVVVVRPDEMVPVDGRILSGESDFNEASLTGEAKPIEKKVGDNIL
SGSMNGSNSIQFEVTSLAEDSQYQQLVRLVKESTSNPAPFVRLADRYSIPFTVIAYLIGG
FAWFISKDPVRFAQVLVVASPCPLILAAPVALVAGMSQASKNGIIIRTGTTLEKLSGAKS
VAFDKTGTITQGNLAVNQIIAVEGTTEEELIQLAASLEQNSSHILARSLVQYAKSKGITF
LPVTSATEVTAQGIIGKISGNEVSAGKPSLIKNFSSENLSKETSIYVGKNDHLLGYITFK
DSVRPEAKETMQKLQQMDVENLVILTGDKDSVAKEIAEQVGINKVFADCLPQDKIKHLKD
IEIQDGPVLMVGDGVNDAPALVTADVGIAMGAHGSTAASENADVVIMKDDLSKVVQVIAI
AKHTMKIAKQSVLIGLFVCLALMVIAATGVIPTLLGAMLQEVVDTVSILSALRARKNV
Download sequence
Identical sequences F5WX66
WP_012962529.1.19369 WP_012962529.1.4451 WP_012962529.1.57133 WP_012962529.1.76930 WP_012962529.1.8633 WP_012962529.1.89533 gi|325979194|ref|YP_004288910.1| gi|288906222|ref|YP_003431444.1| gi|386338663|ref|YP_006034832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]