SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|326802637|ref|YP_004320455.1| from Aerococcus urinae ACS-120-V-Col10a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326802637|ref|YP_004320455.1|
Domain Number 1 Region: 56-150
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.28e-29
Family Ribosomal protein L9 C-domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.66e-16
Family Ribosomal protein L9 N-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326802637|ref|YP_004320455.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Aerococcus urinae ACS-120-V-Col10a]
Sequence
MKVIFLQDVKGQGKKGEIKEVNTGYAQNFLFKKGLAKEATKSAVSALEGKKKAQAKEAAE
ELAEAKELKKKLEDEETVVEVKAKGGEDGRLFGSVTSKQIAQALKKQYDIKVDKRKIDLP
EPIRAFGYRNVPVKLHSDVEATIRVHIVEE
Download sequence
Identical sequences F2I5J4
gi|326802637|ref|YP_004320455.1| WP_013669284.1.64995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]