SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326803149|ref|YP_004320967.1| from Aerococcus urinae ACS-120-V-Col10a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326803149|ref|YP_004320967.1|
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily YheA/YmcA-like 7.33e-29
Family YheA-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326803149|ref|YP_004320967.1|
Sequence length 128
Comment hypothetical protein HMPREF9243_0644 [Aerococcus urinae ACS-120-V-Col10a]
Sequence
MANIYDTINQLERDIRELDAYDALSEAMDKLLNDDEARELYINFRNYQTSVQTKMQLGQE
LSEEDVKKAEDMQKTLANNAVLSELMQKEQQLNQYVEDVNQAVGRPIREIYDRANQATKL
SSEDKDGE
Download sequence
Identical sequences A0A178HDW5 A0A1E9PAJ3 F2I8I4
gi|326803149|ref|YP_004320967.1| WP_013669338.1.23070 WP_013669338.1.45105 WP_013669338.1.64995 WP_013669338.1.86563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]