SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326802999|ref|YP_004320817.1| from Aerococcus urinae ACS-120-V-Col10a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326802999|ref|YP_004320817.1|
Domain Number 1 Region: 213-351
Classification Level Classification E-value
Superfamily CBS-domain pair 5.43e-31
Family CBS-domain pair 0.002
Further Details:      
 
Domain Number 2 Region: 354-440
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.43e-20
Family CorC/HlyC domain-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326802999|ref|YP_004320817.1|
Sequence length 441
Comment hypothetical protein HMPREF9243_0473 [Aerococcus urinae ACS-120-V-Col10a]
Sequence
MEDPGASSILGQIILILVLTLINAFLAGAEMAFVSVNQGKINQLAEEGDRRAVKVVQLLD
KSDDFLSTIQVGITFAGFLSSASAANTFVGYILPYLANIPAAEILATAIVTVILSYISLV
FGELFPKQVAIQIPEKYCLFSAGTISFLNKVFTPFVWLLTASTDVLKAIAPIDFTQREER
LTRSEMRKLIESGRNDGIIDMDEFRMMQGVLSLDSKLAKGVMVPRTDTFMLDIEDDREEN
LQLILQSQYSRIPVYRDDKDDILGIVHAKDVLREANRVGFENIQMENIMREPYFAPETVF
IDDLLLEFKRNHLHMAILKDEYGGVVGLVTLEDLIEVIVGDIEDEYDEMSFKYKKVSDDT
YIIDGSMPIDKFNQLFNAHIYSGDSDTMAGIIIEHLGRFPQDTINESIQVDDYLFTTTDV
DDGRIRKIRVHYQPREDDDNE
Download sequence
Identical sequences F2I7N3
WP_013668635.1.64995 gi|326802999|ref|YP_004320817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]