SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326803019|ref|YP_004320837.1| from Aerococcus urinae ACS-120-V-Col10a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326803019|ref|YP_004320837.1|
Domain Number 1 Region: 21-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.96e-47
Family PP-loop ATPase 0.00041
Further Details:      
 
Domain Number 2 Region: 373-445
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000759
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326803019|ref|YP_004320837.1|
Sequence length 472
Comment tRNA(Ile)-lysidine synthetase [Aerococcus urinae ACS-120-V-Col10a]
Sequence
MLELSQLAQMIYQKLVAEDSDYLASHKPYALAVSGGVDSMVLLRCFETLQAIHGLNFFVI
HINHRLRLESEAEQEMMVAYCQERDLDLKVSIWQHGADLAGNVEAKARAFRYHAFGKILK
DKASLRLVTAHHSDDQVETGLMRLVHGGHLASFKGMESLSPLYTYPKAQILRPLLEVEKA
SLYDIARVEGIPYQEDMTNWDKHFQRNRFRQEIIPYLERESGNFKAHFRHFQTDLKALLD
LAYPQLNQLLANLFDQEAGCFRIDLEALGQYSQAEQVLLMEMLFQRCEIPELLVFTRTGM
EELVDFLNQGAAQGQWALPGHYVLDKVYQAAFIRLKTSPAHYYQTGPELSERPLELEKAV
IQLEDFSLSWTLAGQEKHQDTSQSFYLPHSLSDQSLTIRHRQAGDYLKLPSGSQQKIRRF
FINEKIAQADRQTSWLIVRGQSWVLGILSQKGQWLYRYPLNGEGPFSQIQRL
Download sequence
Identical sequences F2I7Q3
WP_013669209.1.64995 gi|326803019|ref|YP_004320837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]