SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326804320|ref|YP_004322138.1| from Aerococcus urinae ACS-120-V-Col10a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326804320|ref|YP_004322138.1|
Domain Number 1 Region: 196-342
Classification Level Classification E-value
Superfamily CBS-domain pair 6.19e-30
Family CBS-domain pair 0.0036
Further Details:      
 
Domain Number 2 Region: 342-417
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000155
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326804320|ref|YP_004322138.1|
Sequence length 440
Comment hypothetical protein HMPREF9243_2029 [Aerococcus urinae ACS-120-V-Col10a]
Sequence
MDDSFLVSIIIFLVCVILSAYFSSSETAFTSASSIRLQNEAELGDDRAKQALDLQNQFDS
LLSTILIGNNFVNIAASSIATVIFMELIPEYGATIATVFTTVTLLLFSEITPKLIAKIVP
EPFAKFSTPYLRAIMWLFKPLVWLVNQWQKMVQHFFPLEAQEGISEEELLSMVDEARVGG
SIEHDEQRLVKAAIRFDDREVSAIITPRIDVEAIDVSDSDQEIEAIFENQPYSRLLVYEE
DIDNVLGVLHERDFNRYLREKFKHPEKKILLNSLLLDTFSIPQNMKLATLLRQMQAKQIH
MAVVRDEHGGMIGIVTMEDVLEELVGEIWDEDDVVTQDIEVLEEGQHYIFSGGCAIEKSQ
PLLQLPLKEANLYHTINGFATHYLGKLPELGDHFAVGAWVFEVVEEDKQRVGKLDAQRLP
EDEIVGQAAQYEESDHDKEE
Download sequence
Identical sequences F2I8S7
WP_013668483.1.64995 gi|326804320|ref|YP_004322138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]