SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325289316|ref|YP_004265497.1| from Syntrophobotulus glycolicus DSM 8271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325289316|ref|YP_004265497.1|
Domain Number 1 Region: 11-196
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.11e-65
Family Methylesterase CheB, C-terminal domain 0.00000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325289316|ref|YP_004265497.1|
Sequence length 197
Comment chemotaxis protein CheB [Syntrophobotulus glycolicus DSM 8271]
Sequence
METGTQDRKADRIIAIGASTGGTEAIFSILRALSPAIPGIVVVQHIPPVFSRMFAERLDS
QTALQVKEAQTGDYADAGRVLIAPGDRHMRVKRIGSRYRVECFDGNKVSGHCPSVDVLFE
SLAREAGRRAVGILLTGMGYDGARGLLAMRRQGSRTIGQDEASSVVYGMPKAAFEIGAVE
RQAALGRIPQVLAELIG
Download sequence
Identical sequences F0SUK3
gi|325289316|ref|YP_004265497.1| WP_013624366.1.55828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]