SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325289405|ref|YP_004265586.1| from Syntrophobotulus glycolicus DSM 8271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325289405|ref|YP_004265586.1|
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily AF1862-like 4.71e-33
Family Cas Cmr5-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325289405|ref|YP_004265586.1|
Sequence length 129
Comment Cmr5 family CRISPR-associated protein [Syntrophobotulus glycolicus DSM 8271]
Sequence
MPNEIENGRASFAYERVLAVSTEKSEKYAKDYRALVRSFPVMIQTNGFGASVAFLFSKKK
NNQHEAVYNDISKWLKEQKLIDNELMEAITKQTRNGYRRMTNETMALLIWMKRFAEGMIE
GESSEKQSC
Download sequence
Identical sequences F0SV85
gi|325289405|ref|YP_004265586.1| WP_013624455.1.55828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]