SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325290949|ref|YP_004267130.1| from Syntrophobotulus glycolicus DSM 8271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325290949|ref|YP_004267130.1|
Domain Number 1 Region: 22-377
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 4.71e-71
Family Homocysteine S-methyltransferase 0.0000287
Further Details:      
 
Domain Number 2 Region: 327-606
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.06e-55
Family Methylenetetrahydrofolate reductase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325290949|ref|YP_004267130.1|
Sequence length 613
Comment homocysteine S-methyltransferase [Syntrophobotulus glycolicus DSM 8271]
Sequence
MKKGSHQTQVKTKQEQRNEVEMNIREYLKTNTLIFDGAMGTYYAQLEKKPLVKCEMANIH
DEEAILRIHHEYIRAGCMAIKTNTFGANVTCLDCPFEGVEEVIRKGYELARRAVAGSGVY
LFADIGPIPFRDNENLFAEYQKIADLFLDLGAVNFLFETFSSAEYLAQIAAYIKEKSPQA
FIITEFAVSPDGYTRQGNSGFQIFEELSGENSIDAIGFNCISGPYHLLQLAKKLEAKDKF
VSIMPNAGYPTVIDNRTFFENNAGYFADQMLEMAKEGIAILGGCCGTAPEFIRKTAAKIK
SLSLPEPAVKRIKITEGKPAAQAENPLMEKIRQGEKIIAVELDPPANTDIDFLMRSAQKL
QENKVDAITIADCPIARARVDSSLLACKLKKELGVTPIPHMTCRDRNINATKALLLGLNI
EGVNNVLVVTGDPIPSAQRDEVKARSNFNSAILANYIRTLNENTFARPFTIYGALNVNAR
NFEAQLKHARKKIENGVSVFLTQPILTKKALENLQEASRVLPAKILGGILPIVSYKNACF
MNNEISGIDVSPEIMDLYENASKEQARNLAVDISTRMVREISAYVDGYYLITPFQRLDIV
TDILENMLQSQAG
Download sequence
Identical sequences F0SZ11
gi|325290949|ref|YP_004267130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]