SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325290611|ref|YP_004266792.1| from Syntrophobotulus glycolicus DSM 8271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325290611|ref|YP_004266792.1|
Domain Number 1 Region: 34-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.45e-43
Family Phosphate binding protein-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325290611|ref|YP_004266792.1|
Sequence length 261
Comment molybdenum ABC transporter periplasmic molybdate-binding protein [Syntrophobotulus glycolicus DSM 8271]
Sequence
MLKKIGGFILIIVFCIGILGCSKEQNIQTSAQAKTLTAYVGANLKDPISELASSYEQKTG
VKVELNFNNSGTLLNQIETTKKGDIYIPGGMAAIDQGKQKGLIDQVAGPIAYTTPVIITP
KGNPAQISSVEDLAKQNVKLIIPDKDATAIGKSAYIVFNKIGKTKEIEKNIIAVVESPAK
VLAAIEMGQGNAGIVEFSNTQKDKDRIDIIEIDPKVNAIDQVPVASLVYTTNKDLANDFL
KYLQENGPEVFEKYGFKIKMA
Download sequence
Identical sequences F0SW07
WP_013625656.1.55828 gi|325290611|ref|YP_004266792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]