SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333891636|ref|YP_004465511.1| from Alteromonas sp. SN2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333891636|ref|YP_004465511.1|
Domain Number 1 Region: 148-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.19e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000036
Further Details:      
 
Domain Number 2 Region: 429-561
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.1e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000149
Further Details:      
 
Domain Number 3 Region: 13-144
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.25e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00024
Further Details:      
 
Domain Number 4 Region: 347-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333891636|ref|YP_004465511.1|
Sequence length 572
Comment sulfite reductase subunit beta [Alteromonas sp. SN2]
Sequence
MSNEKSPFIVEGKLADNERLKRESNNLRGTIETDLKDDLTGGFTADNFQLIRFHGMYQQD
DRDIRAERAKQKLEPLHNVMLRARLPGGVITPDQWLAIDKFAADHTMYGSIRLTTRQTFQ
FHGVLKPKIKSMHQMLNKAGIDSIATAGDVNRNVLCTSNPVESALHVEAYAWAKKISEHL
LPKTRAYAEIWLDGERVETTEKPVEPILGDNYLPRKFKTTVVIPPQNDVDVHANDLNFVA
IAENGKLIGFNVLVGGGLAMTHGDKSTFPRKASDFGFIGLDDTLAVAAAVVTTQRDWGNR
VNRKNAKTKYTLERVGVDNFKAEVEKRAGVTFGETRPYEFTTRGDSFGWVEGIDGKYHLT
LFIENGRILDYPGKTLKTGCAEIAKIHTGDFRLTANQNLIVAGVPAEDKEKIEALAREHG
LIAPETSNQRLDSMACVALPTCPLAMAEAERYLPDAVTELEGLLAKHGLADDSIIFRVTG
CPNGCGRAMLAEVGLVGKGPGKYNFHLGGDREGTRIPKMYRENISEEEIMAELDSLIGKW
AKERNGNESFGDYVIRAEIVAPVVDSARDFYE
Download sequence
Identical sequences A0A0S1YFN5 F5Z9E1
WP_013782651.1.100108 WP_013782651.1.22588 WP_013782651.1.25357 WP_013782651.1.40109 WP_013782651.1.58535 WP_013782651.1.61287 WP_013782651.1.86897 gi|333891636|ref|YP_004465511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]