SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333894473|ref|YP_004468348.1| from Alteromonas sp. SN2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333894473|ref|YP_004468348.1|
Domain Number 1 Region: 632-807
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.66e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 6-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.73e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0045
Further Details:      
 
Domain Number 3 Region: 151-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.71e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0068
Further Details:      
 
Domain Number 4 Region: 501-640
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.78e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.022
Further Details:      
 
Weak hits

Sequence:  gi|333894473|ref|YP_004468348.1|
Domain Number - Region: 346-392
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00309
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333894473|ref|YP_004468348.1|
Sequence length 849
Comment nitrite reductase [Alteromonas sp. SN2]
Sequence
MTSLASKTRILVVGNGMVGHHFVEQLHQSSDNVDITVLCGESRLAYDRVHLSSYFSGASA
DDLALTTADVYREWGVNVVTNAIVTDLLRDEKKALTEDGQVFPYDKLVLATGSYPFVPPI
PGNDQEHCLVYRTIDDLIAIENSARESKVGVVVGGGLLGLEAANALKEAGLETHVVEFAP
QLMAVQLDETGGDVLRSKIESLGVTVHTQKATQVIEAGEQSRYRMVFADGTFLETDMVLF
SAGIRPSDQLARKSMLALGERGGIVVDDNCLTSDPDIFAVGECALWQNRIFGLVAPGYTM
ARAAVSALTGGDTVFTGADMSTKLKLMGVEVGSIGDAHERTTGAQSYTYFNQPEGVYKKL
VVDESQQKVLGAVLVGDTSDYDTLLQYALNGIDLPENPETLILPSAGAAPALGADALPDT
ATICSCHNVAKSDIVSAIDEGCCSLSDVKSCTKASTGCGGCTALLKNVVDSELEKRGVEV
SKAICEHFNHTRQELFHIVKVNGITSFDELLDKHGTGLGCEICKPAAGSILASVYNDYVL
KQEHLPLQDTNDIYLGNMQKDGTYSVVPRVAGGEITPEKLILLGEVAKKYSLYTKITGGQ
RIDLFGARVDQLPDIWEALVKGGFETGHAYAKALRTVKSCVGSTWCRYGVQDSVKTAIDL
ENRYKGLRAPHKIKFGVSGCTRECAEAQSKDIGVIATENGWNLYVCGNGGMKPRHADLFA
TDLDTETLVKYIDRVLMFYVRTADRLQRTSVWMDNLEGGLAYLQDVVMNDSLNINADLEA
QMETVVGAYQCEWKTTLESEASRKRFRQFVNTDGTDTNIQFVSERGQVRPATELEKSKGA
DNLIAVDVI
Download sequence
Identical sequences F5Z4X9
WP_013785470.1.40109 gi|333894473|ref|YP_004468348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]