SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326800098|ref|YP_004317917.1| from Sphingobacterium sp. 21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326800098|ref|YP_004317917.1|
Domain Number 1 Region: 23-254,318-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.44e-69
Family Type II chitinase 0.0000202
Further Details:      
 
Domain Number 2 Region: 254-316
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000825
Family Chitinase insertion domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326800098|ref|YP_004317917.1|
Sequence length 362
Comment chitinase [Sphingobacterium sp. 21]
Sequence
MYKGLLIALVSLISLTNLSAQQRRDFSVIAYYTGNDKQIDQFEINKLSHIIFSFCHLKDG
ELHVDNAKDSTTIQYLVSLKKNHPKLKIMLSLGGWGGCEPCSEAFSTSNGRTKFARSVKK
VNDYFDTDGIDLDWEYPTIEGHPGHLYQAQDKQNFTALIQELRQVLGSANELSFAAGGFQ
KYLDESVEWEKIMPLVDRVNIMSYDLVNGYATVTGHHTPIFSTHDKEESTDRAVQFLLKK
GIPANKLVIGAAFYTRVWEHVNDVNNGLYQAGRHRSGYDFKSYATNLTTQNEWAYFWDEK
AQAPYWYNKKQKLFATGDNLTSVKAKTKYALDNKLGGIMFWELTLDTFNDGMLNAIDQVV
KQ
Download sequence
Identical sequences F4C1H4
gi|326800098|ref|YP_004317917.1| WP_013665968.1.8815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]