SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326800584|ref|YP_004318403.1| from Sphingobacterium sp. 21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326800584|ref|YP_004318403.1|
Domain Number 1 Region: 123-273
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.22e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00045
Further Details:      
 
Domain Number 2 Region: 395-559
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00095
Further Details:      
 
Domain Number 3 Region: 20-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.34e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 
Domain Number 4 Region: 255-279,308-409
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.015
Further Details:      
 
Weak hits

Sequence:  gi|326800584|ref|YP_004318403.1|
Domain Number - Region: 584-633
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0863
Family HEPN domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326800584|ref|YP_004318403.1|
Sequence length 697
Comment ferredoxin--nitrite reductase [Sphingobacterium sp. 21]
Sequence
MQSFRTELENPVVEQDIIDLEKKIHAFRQGSIHDEKFRSLRLARGIYGQRQPGVQMVRIK
LPFGKVTFKQFLRIADIADEYGSGNLHLTTRQDIQIHYVSLDRTPELWSKLAADDVTIRE
ACGNTVRNVTASPTAGIDPDEPFDVSPYAYATFDYFLRNPICQEMGRKFKIAFSSSEKDT
AYSYVHDVGLIPKIDPSGKRGFKVVIGGGLGAQPILAHLIYEFLPEDQLIPFIEAVIRVF
DRYGERNNRNKARMKYLIQKLGLDEVLQLIEKEKIAIKAKQLPIDIDAVKAPNIPVNTVL
EDVSDAERLQYEYWLKTNVFEQKQKGYYGVYIKVLIGDIKTDLAREFISLIQPLVADEIR
ITQNQGLLLKYVPEAHLPALFHALNKIGFAKIGFDSVADVTTCPGTDTCNLGISNSMTLA
TVLEDLVYEEYPEFVFDKDIKIKISGCMNSCGQHGLAEIGFHGSSLKAAGKVVPAVQVML
GGGTVGDGVGRAAERVIKTPSKRATDVLRSLLDDYKANAEKGERFQQYYDRQGKDYFYQL
LKPLADLSNLNEEEFVDWGHEETFKTAIGVGECAGVVIDLVATLLLEAEEKLSWANQALD
NGAWSDAIYHAYSTLISSAKAMLLDKGVNSSTHIGVINDFDAKYVDSGEIDLPTSFAEMV
LKINKEEPSANFAQAYFKQAEEFLKLTRTKRETVLQS
Download sequence
Identical sequences F4C3X2
WP_013666453.1.8815 gi|326800584|ref|YP_004318403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]