SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326799500|ref|YP_004317319.1| from Sphingobacterium sp. 21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326799500|ref|YP_004317319.1|
Domain Number 1 Region: 4332-4432
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 3.14e-21
Family Invasin/intimin cell-adhesion fragments 0.0015
Further Details:      
 
Domain Number 2 Region: 3822-3922
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 4.12e-21
Family Invasin/intimin cell-adhesion fragments 0.0014
Further Details:      
 
Domain Number 3 Region: 3924-4024
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 4.71e-21
Family Invasin/intimin cell-adhesion fragments 0.0014
Further Details:      
 
Domain Number 4 Region: 4128-4228
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 4.91e-21
Family Invasin/intimin cell-adhesion fragments 0.0014
Further Details:      
 
Domain Number 5 Region: 4230-4330
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 8.63e-21
Family Invasin/intimin cell-adhesion fragments 0.0015
Further Details:      
 
Domain Number 6 Region: 4026-4126
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 3.34e-20
Family Invasin/intimin cell-adhesion fragments 0.0016
Further Details:      
 
Domain Number 7 Region: 4434-4533
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 7.65e-20
Family Invasin/intimin cell-adhesion fragments 0.0012
Further Details:      
 
Domain Number 8 Region: 4536-4636
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.96e-18
Family Invasin/intimin cell-adhesion fragments 0.0017
Further Details:      
 
Domain Number 9 Region: 3721-3812
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.96e-18
Family Invasin/intimin cell-adhesion fragments 0.0014
Further Details:      
 
Domain Number 10 Region: 2258-2372
Classification Level Classification E-value
Superfamily PKD domain 0.0000114
Family PKD domain 0.0046
Further Details:      
 
Domain Number 11 Region: 3629-3719
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000416
Family I set domains 0.061
Further Details:      
 
Weak hits

Sequence:  gi|326799500|ref|YP_004317319.1|
Domain Number - Region: 1648-1686
Classification Level Classification E-value
Superfamily Bacterial adhesins 0.0323
Family Fibrinogen-binding domain 0.035
Further Details:      
 
Domain Number - Region: 2158-2213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0336
Family I set domains 0.035
Further Details:      
 
Domain Number - Region: 2185-2272
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0418
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326799500|ref|YP_004317319.1|
Sequence length 5215
Comment hypothetical protein [Sphingobacterium sp. 21]
Sequence
METTFTFRKSFSHFVFTVLAVFFAVFGMTGKGYGQTKSYATWTPSAEKLTPIGLSLLPGD
GGVTNKNNAAIPTESEFATVMADRVAALGIVVRGSDAALELKFPTSRPAGTTTLIRISQP
ALNAANVSLGDILGLAGSSITAEIYSGASDSDDGVGTKIDTEVLTKMLVDGSGNYYLAVT
PNGLNQYNAVKLIFRFPDGLVQIGQFTMNVYNAFSIDDVTCGVANFASVGETTGITASLT
DVVQNPQRAIDADTSSFSVLTAGTLGVGNSVFQSFYFNGLSGQQDYFKIKLAIGGGALNL
SLLGNYEVRAYNGNTLVYSKKLQGGLINGLDLLSLLQNGNPVTIPFGPGVPFDRVSIGIS
AIANVGLADSPLRIYHVERYGSAGSTLTCVDPNPPFTGGNEHMLGNNRACANTVISYEHA
DFPFNAADGGTNSYTTLEASSGLAANLGAYSGHIELGLGAPIPADTTVYVRIDFDNEVLG
ALLDGTLGGLLNDVVGSTLFGNHYFTVEAKNGATSVLTRSSNEAFSENGLSAQGQGKVKI
VQDKYGHYYIALTSNTAFSSIRITERLSSLLGVGTVKHMNVYHACYSTGFEPCEQAFATY
TASNGISLDLLGVGNAGVSNAQNAIDGDVNTASSISIGAAGIAASVYQYVDFHGLSAETD
HFRVKLRMDGGSALSAEVLGSIVVKAFNGDQEVFSQRLRDGLVSDLDLLDLLQGGQVLSL
PFGPGRPFDRVAVGIESLLSANVINNPLQVFSIERFSAACPDPELQDPPVTTPPFNNQDC
GTTVTSFENTNFPLNTIDGKNDTYATLYAGTGTALGLGAFSSHIELAYPNAIPAKETSYI
RIDFEDDMLNSLLGGSLGGALADLAGGLLLGNHYFEVMLKDANGNQIYNASSVDGFSDQA
VKVVKDANGRFYIAVTADVPYQSVRITHGLAALIGGNNTATMNVYSMCRETEFNPCEQAT
FTSFDGSGLTLDLLDISKGGIFNSQYAIDENSSNYSTINLGVAGVGATVYQNIYFKTKSA
ATDSLRLRVQLDQPGILNVDLAGSYRIKLFNGDDEVYNQPLQSSLINNLDLLGLLNTGGI
IQLTIAPGVVYDRVQFGLQSVASINTSAPLRFYGVSRISENCPDPDFLEPPYRNPVCADD
LVSAEHTDDLQNLFDGNHNSYATIRSDAGVTKYSGHVEFGYAAPVAAGTTSYIRIDTEGG
LLDALLAGSVGKVLTDILNNVVLGNHYFHVYVKDASGATVVSGSSEDSFTGSTTGMNPNK
QIRVVQDNAGRYYLAITPNTAYQSVRIEDHTDALLLGQNNSMNVYGMCYETDFEGCAEAF
TTSFDGSGLTAGLTGIGNYGVQNPYRVLDNNNNGDYSEISLGALSVAGAIQQNVQFNKEI
EANSIFKIKMAVGTGTLDAGVFGRIDVVGYNNGQEVYVETLENAVVGNVNLLQLFNNGAS
PEISVSPDVAVDELAIRLRSLVGVTVVPNVRLYYIQQDCDAVSDFVAWKSYAVNADPSIA
SVKGGEEVTYTIHIRNTGTVDLAGLSVTDTIPAHTTYVDGSGGVLAGNAVTFENVAVAAG
ATTTLSFKVTVNADLTDVTQISNTAFVKTDANDPGKPTYPPANNATPTDPDTSGPTGTNI
PVDQISSLVSWKAYKVNGDASITSVSGGEEIEYTIYVRNTGNQALTNVNITDPIPTGTEY
VSGGTSANSAVSFTIPTLAVGETSSPQVFTVKVKANLTGLTEIRNVAAVTSNEVGTPTES
FPPVDNTNPTEPNDTGGTGTVIPVAPADNLVSWKAYKVNGSADSTAVRGGETVEYAIYVR
NNGNQDLTNVVISDVLPAGLTYVSGGSLAGNTVTFTIPSLAAGQTSTPQIFTVKVNEDLT
GIDVIRNLATVVSDELTTPIESFPPVDNTTPSEPDTTGTTGTPLDVTPLHDLDLALTGTS
DGANSGRAVSNDVITYTVTVTNNGNKALTNVNLVDAIPQNTTLESAGDFTQNGNNLELTI
PTLTVGETQTYTFTVRVNTIDPTVVTSIDNSVTATYRNEDNTADKSETATHSMPTDCTPI
DASNITLAGAENPICAGEEITLTAAFSGLTTPPSAGSVKWYTTADLSGTPLTGLSITVNP
EVNTTYYVVVEGDGFCFNNPPAQISVTVSAMPETPTITATGANPFCEGGFTTLVASGNAD
SYKWFNNGVEITGQTSANLEVSTAGQYTVIALNAGGCESSVSASFAVQMNPRPAQPTVQL
DGDAAICSGTEVTLTSSATAGNQWFKDGVEIQGATQQTLTVNEAGTYTVIVTDPNTGCTS
LASTDLVITVNPTPEITINGNAAISAKVGEAVQIPGVTTDPTGLTPTWYDNDGNVTTNLN
PTFSTPGVYTYTAVVTNGGCSASATVVITVYDENACPPLVERVYANTQTWSAVLTGDVEN
PTNAVDGNPQTHATLRTLLGVAGIGSVRQNLLFAQEVEAGTPVSVKFGKELSAVGLISGV
SVVGLDADGNEIGRPQNVQGGLLDLLVGDNVAEFTFVPADNSGPKNYKGVRVIQAAVLSV
AQNTRVYGAYVTQNSTTNNCAPVVPGVKANVIDVLHGVRDIGLGALSATSSVSNAWNAVD
NDTTSFATISRAAAVLNEAFLTVAFKTQSQLNDSIRIVTEVPNDPILQLELLKGYTIQRY
LGETPVGEPLDEDSGLLNLKLLGLLGSSQRAAIIVAPTNEPFDRVRISYGSVASVLGNTT
NIYDINLKPTISPVVDPDGELKLCLGDSIELNKVDDCTVYKIFDAAEGGNELTTSDGFRF
ALPDGLAAGEHTFYVQAVRQGCEVGARIAITVTIKPTAVEADINNILVNGAELTAPLCLE
PNEEVVLTASLSATSTVVNPVFHWYNEAGAAVSGGENGTLNLGVLAAGTYTYQVGVSGDN
VCESLPADRKSVTFVINKQAVDTDINVIGEGAHCFGSPVVLTPSASDANVTNPIFKWYST
ADKSVEIVNGTVAGITYAIDAATGVLTITGLPINATPYTFYVTMSADGYCENESGRAVDV
TVSSELDAPTFDTTNLLVCEGENASFTLTNSQPSITYHFYDANGVEITDPALISHDATTN
AVVIHNVTASVSYLVESRDAGGCISGERTTITAGVKPVFTEPITVTINGQTPSTGICTDP
AGNVVLAATVDAAITLTNPVFHWYDGAGAAVTGGEDGTLELVLTPGTYTYTVGVSSDEYC
ETPAADRTSVTFTINRKGVPGDIDIATYPTDLCAGEEVTFTASSTTVTNPIFRWYTTADL
SDTPVEGASFMPTTLATGVNTFYVTVSGDDVCEGDASAAVSVTINVNATVEAPRVQTEVT
VSVGQSIDITAALGETQTGDPADYEIVWTYDNNGTPAEFIGATFTVPNDLPVGVKTYEVS
VRSKVGALCESPKVTVTVNVTEVINDDCLEANAQTNGTNGICLLCGVSDAGNAVDGNPET
YAVLQRTVNVLGKVWQELIFPNGGKQGDTVSVWLSGNNSILDASILGGLNIGTYNGATNN
NDGSQTGAILDITLFPGSTTIQQFKFIAGADFDRVRIEQYEAVGLLANGLRIHGANLELP
APTDIQPVDGTAYCQGDEITLSATAAPNTQLRWFDDEGNLIGEGATVTTTAPTDKTGEVI
YEVVAFRTNTGGEICYGERIPVKLVINDKPEITEQPANLTLAPGSTATFNVVATGTGLTY
QWEQLEGTTWTALPGETNSSLSLTVPLVPAGTVYTYRVVVSSTTGCDVISAQATLTVTAQ
EVDFTKSNLAVTKDGAIADGVDHNEVTATLLDAFDNPVANKDVVFTIVNVDGTTRDTTIT
TDANGKALATITSIKAGEASVTATVDGTAITVGSPAIVTFVAGPVDHDKSRLEVTKDGAV
ADGVDYNEATATIVDANDNPIAGQDVVFDITNVDGTTSQQTVTTDAAGKAIVRVTSTKAG
EATIAATVGGTAISGSPVTVTFVAGPVDHDKSRLEVTKDGAVADGVDYNEATATIVDAND
NPIAGQDVVFDITNVDGTTSQQTVTTDAAGKAIVRVTSTKAGEATIAATVGGTAISGSPV
TVTFVAGPVDHDKSRLEVTKDGAVADGVDYNEATATIVDANDNPIAGQDVVFDITNVDGT
TSQQTVTTDAAGKAIVRVNSTKAGEATIAATVGGTAISGSPVTVTFVAGPVDHDKSRLEV
TKDGAVADGVDYNEATATIVDANDNPIAGQDVVFDITNVDGTTSQQTVTTDAAGKAIVRV
TSTKAGEATIAATVGGTAISGSPVTVTFVAGPVDHDKSRLEVTKDGAVADGVDYNEATAT
IVDANDNPIAGQDVVFDITNVDGTTSQQTVTTDAAGKAIVRVTSTKAGEATIAATVGGTA
ISGSPATVTFVAGPVDHDKSRLEVTKDGAIADGVDYNEATATIVDANDNPIAGQDVVFDI
TNVDGTTSQQTVTTDAAGKAIVRVTSTKAGEATIAATVGGTSISGSPVTVTFVAGPVDHD
KSRLEVTKDGAVADGVDYNEATATIVDANDNPIAGQDVVFDITNVDGTTSQQTVTTDAAG
KAVVRVTSTKVGQATIAATVNGTAINGSPVTVNFVVNPTDTGKSKLEVTKDGAVADGVDY
NEATATIVDAFENPIANKDVVFDITNVDGTTSQQTVTTDAAGKAVVRITSTSAGQATIAA
TVDRMGISGSPVVVNFVRPYNLSITKVADQARVKAGESTTFTVTITNEGPTAIPSGKVIS
LTERPGNGVSITGYEVTSGNGTINGTGNTPTVTTSANIPVNGTIVVKVTAQIAVDAPATI
TNGISVWGPDKPITEDPDDEDDTPEIPVDRDAQLSITKVADQARVVAGTSTSFTVTITNN
GPAEIASGKVITLTERPGSGVSITGYEVTSGNGTASGNATAATVTTNKVIPVNGTIIIKV
TATVATDAPATITNGISVWGPDKPTTEEPDDEDDTPEIPVDYVSNLSITKVADQARVQAG
ESTSFTVTITNNGPSDILSGKVINIAELPSEGLSITGYEVTSGNGTASGNGNTATVIANT
KVARGGTITMKITGLVNAEAPAVISNGIQVWGPDKPVTQDPDDEDQTPEIPVDYQLPEAA
DDEAETTSATPVTINVLANDRATRWPLNVASVEIVNAPQNGKVAVNADGTVTYTSDKGYV
GTDRFTYTVKDEKGNVSNAATVMVNVIPNPLFIPNAFTPNGDGKNDQFEIMGIEGYDRVE
LYVFNRWGNEVYNNPNYNNNWDGQNLNEGTYYYLIKLIKEDKVETQKGWVLLKRQ
Download sequence
Identical sequences F4CBQ7
WP_013665371.1.8815 gi|326799500|ref|YP_004317319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]