SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326801129|ref|YP_004318948.1| from Sphingobacterium sp. 21

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|326801129|ref|YP_004318948.1|
Domain Number - Region: 11-56
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0576
Family DsrA/DsrB N-terminal-domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326801129|ref|YP_004318948.1|
Sequence length 415
Comment rubredoxin-type Fe(Cys)4 protein [Sphingobacterium sp. 21]
Sequence
MAENLLSVYDRAHLVRVFVKGGMIAPNYLLSVLRASELANNDFVHFGSREDILFPVEQSR
LPIVEQHLTMHQIDFEYGKRDAFQNIVSSAIALDITANTSWLNLEKYRFILESFHFVPRL
KINLSDPKQAMVPLFTGHLNFVASEYTDYWYLYLRSEQNRHELEKWPTLIHSSDLPKLSK
FIESKWQKNPKLLLPDLIVGLAEYLKLDSIVSNDELKLPDTFFPYYEGLNNVDETNLWLG
LYWRNNRFDIEFLKKSCTLCIESGIPFIYISPWKSFVIKGIKSTHQLKWEKLMGQMGINM
RHSSLELNWHIPVLDEEALLLKRYLVQELDQQDICTHGLTFTIETAEDKRWFTSIVIQKD
NILSSHHLAAYNVLYAKGFNPNSTIYYSYAKLVGKEILPALLIELSKLYYKRFRI
Download sequence
Identical sequences F4C4B6
gi|326801129|ref|YP_004318948.1| WP_013666995.1.8815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]