SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333910092|ref|YP_004483825.1| from Methanotorris igneus Kol 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333910092|ref|YP_004483825.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-40
Family GHMP Kinase, N-terminal domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 190-314
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.5e-29
Family Mevalonate kinase 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333910092|ref|YP_004483825.1|
Sequence length 317
Comment mevalonate kinase [Methanotorris igneus Kol 5]
Sequence
MVVVESPAKVILFGEHAVVYGYRAISMAIDLKTTCTVEESDTTIINLKDLKKSLKIPIEE
ILNLNVNEYGDFRYVLCAIKNTILYLLSHKNLDLKDLKPFKLTITSQIPISCGLGSSAST
TISTIKGISAFYERPLDDNEIATIGYHVEKEVQGKASVTDTATITYKGLLEIENNTIRRI
EGGLKDFIKSCKFLICYCEERKKKTAELVNEVANHKNRDDIFKLIEKVVDTSKTTFDKEI
FGELMYINHNLLKRLGVSTPKLDEVVEIGKTYGYGAKLTGAGGGGCVIILVNENKEDELI
NKLKEKGVEYFECRMVY
Download sequence
Identical sequences F6BA70
WP_013798369.1.88808 gi|333910092|ref|YP_004483825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]