SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333911196|ref|YP_004484929.1| from Methanotorris igneus Kol 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333911196|ref|YP_004484929.1|
Domain Number 1 Region: 5-160
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-24
Family GHMP Kinase, N-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 226-270
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000000291
Family Homoserine kinase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333911196|ref|YP_004484929.1|
Sequence length 285
Comment shikimate kinase [Methanotorris igneus Kol 5]
Sequence
MSMKATAIASASGTIINAIATGKGSAFGINLKVKATVELFDDGKNKIEGIVKDNPKVKPN
LIKRCVKNVLDYFGLNYSAKVETETQIPIKSGLSSSSATSNAVVLATFAALGEKIDDELV
LDLGIKSSFDEKLTVTGAYDDATASYYGGITITDNIERKILKRDKFKDDLKVLVLIPNLK
KNVDVNRMKLLKDYVEVAFNECLNGNYYRALFLNGILYASALNFPTNIAIEAIENNAVTA
GLSGTGPSYIALCYEEDVEKVKKTLEKYGRVISSELDYGGAEVIG
Download sequence
Identical sequences F6BER7
gi|333911196|ref|YP_004484929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]