SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326797084|ref|YP_004314904.1| from Marinomonas mediterranea MMB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326797084|ref|YP_004314904.1|
Domain Number 1 Region: 636-808
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.07e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 6-194
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.86e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0064
Further Details:      
 
Domain Number 3 Region: 505-644
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.11e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.021
Further Details:      
 
Domain Number 4 Region: 153-312
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326797084|ref|YP_004314904.1|
Sequence length 848
Comment nitrite reductase (NAD(P)H) large subunit [Marinomonas mediterranea MMB-1]
Sequence
MTTNQNKPRIVVVGNGMVGHHFIEQLIQSGANQTFDVQVFGEEKYIAYDRVHLSEYFTGK
NAEDLSLTTSEFYKDNNIDFHADTKVVAIDAPANSIRLDDCTQVDYDKLILATGSYPFVP
PIPGHKRDNTFVYRTFDDLDAMRECAKDCKTGTVVGGGLLGLEAANALKNLGLETQVVEF
APRLMPVQLDETGGAMLKDMIEGIGVDVYTATATNEIVDGEAAFHRMNFADGSHLETDLI
LFSAGIRPQDELARTSGLTLGERGGIEINNVCQTSVDNIYAIGECALWNGKIFGLVAPGY
TMAKVAADHVIGNNSLAFEGADMSTKLKLLGCDVGSIGDAHQATQGAKSFVYQDEISNAY
RKIVVSEDGSKLLGAVLVGDNSYYDTLLQYYLNGIDLPKEPQGLILPASDGAPAALGVDA
LPDTASICSCHNVTKADINAAVAGGATGVADVKGITKAATGCGGCAALLKKVVDNELLAL
GIEVSTDICEHFAYTRQDLFNLIKVEGIKTFAELLDKHGKGKGCDICKPAVGSILASVWN
DYVLGKEHVALQDTNDRYLANMQKDGTYSVVPRIPGGEITPDGLIAIGDVAKRYNLYTKI
TGGQRIDLFGATLPQLPKIWSELVDAGFETGQAYGKSVRTVKSCVGSTWCRYGVNDSVGM
AIYIENRYKGLRGPHKIKFAVSGCTRECAEAQSKDIGVIATENGWNLYVCGNGGMKPRHA
DLFATDLTDEELIRYIDRVLMLYVKTADRLQRTATWMDNLEGGLDYLKDVIIEDSLDLGA
ELEAQMQHIVDTFQCEWTTTLKDEKALKKFRQFVNADEEDNNVVFVEERGQIRPATESEK
YELIAKAV
Download sequence
Identical sequences F2JXS0
WP_013662970.1.74740 gi|326797084|ref|YP_004314904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]