SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325956277|ref|YP_004286887.1| from Lactobacillus acidophilus 30SC

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325956277|ref|YP_004286887.1|
Domain Number 1 Region: 7-82,175-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.77e-50
Family Bacterial dinuclear zinc exopeptidases 0.00023
Further Details:      
 
Domain Number 2 Region: 72-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 4.58e-21
Family Aminopeptidase/glucanase lid domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325956277|ref|YP_004286887.1|
Sequence length 360
Comment aminopeptidase I zinc metalloprotease [Lactobacillus acidophilus 30SC]
Sequence
MEKAQEIEMLKEFSDANATSGFEEEFVKLFTSYAEKTANIETDGMLNVYASKKENKGNRP
VIQLDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKVRNRDGEYIPGVVATKP
PHFMTAAERNNVPDVDDMSIDVGSSSREETIKDYKIDTGCPIFVDVKCEYHEKSGLFFGK
DFDDRFGAGAMIDVLDNLKGEETNFDVVAALSSQEEVGLRGAYVTARKVKPDLCIVLESC
PADDTFTPDWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACDLADKINIPYTRSVRTGGGQ
DGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDFKASVDLATAVIRDITQEKLDSFKKF
Download sequence
Identical sequences F0TDF6
gi|325956277|ref|YP_004286887.1| WP_013641614.1.69766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]