SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325957314|ref|YP_004292726.1| from Lactobacillus acidophilus 30SC

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325957314|ref|YP_004292726.1|
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Formyltransferase 3.01e-56
Family Formyltransferase 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325957314|ref|YP_004292726.1|
Sequence length 198
Comment phosphoribosyl glycinamide formyltransferase [Lactobacillus acidophilus 30SC]
Sequence
MRVAILASGNGTNFEALTKQFQAGEIPGTEALMFCNHPNAPVIKRAERLGVPYETFSVKE
CGGKDAYEKRLLKVLQDYQIDFIVLSGYLRVVGPTILNEYPNSIINLHPALLPKYPGLNS
IERAFDDYKKGKIKETGVTVHFIDAHLDHGPIIAQQAVPIYPDDTVDTLEARVHETEHKL
FPATLRKVLSQRMEKEEN
Download sequence
Identical sequences F0TGE3
gi|325957314|ref|YP_004292726.1| WP_013642315.1.69766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]