SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308189622|ref|YP_003922553.1| from Mycoplasma fermentans JER

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308189622|ref|YP_003922553.1|
Domain Number 1 Region: 712-852
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 7.85e-44
Family Glucose permease-like 0.000089
Further Details:      
 
Domain Number 2 Region: 578-647
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.000000000000772
Family Glucose permease domain IIB 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308189622|ref|YP_003922553.1|
Sequence length 866
Comment protein-N(pi)-phosphohistidine--sugar phosphotransferase [Mycoplasma fermentans JER]
Sequence
MTTAQTTGIENKKSKPKDNSRKGNFRKILSKISGAFMLPISVMSIAGLFLGVGATISSQS
AIVLNNNPLSSAAKAGIVIGDFIKLLGDPIFGAMPLLFAAAFVVAFTDEAGVGVFAAIVG
YLVFSAIQAPFIQSVIEKTNIDGTKQASELIGKTILKDDKTGQLYYETLKGYNILWMTGK
FGAEVKQVVGSSLGFKTLQTSVFGGIFVGLIVSYLYNKLHTIKLPTVISFFGGKRFVSLI
TIVAMIPLAFLFLLIWPWVGIGLSYFGNSLGHVPYGIESFVFGYIERSLIPFGLHHAFYA
PLWYTNAGGDILKALEDWEARGNTFSGDATALTAYNGWKALMASKHNEWMGDSYAAIGVM
KLNFNTITWKDATPAHEVHTLPLYKFVASELGIKLGRFMQGKYSFMILGLPGAAVAMILA
APKENRKVAAGTVIPAALTSVITGVTEPIEFTFLFLAPWLFWGFHAFFCALSFLLANVLG
VHIGMSFSGGIMDLIIYGIIPVMKGTNFWWALAVGVPYFFIYLGGFYFFIKKFNLATPGR
GETVRLFTKKDFQAKQDGNDENSSSKDTSARNAREYAMILALGGPKNIVNTNNCASRLRY
DINDRNLVNEVECKAAGAVALKWEGDKHVQVIVGPVAEQMNANIRKILASGELDDIVVEA
KSEPTQPVVVVEAPTQEQPTVQETPAVTPEPQVETSSMTETKWVDESNDLERPVEFFAPA
VGDVIPLSQVPDETFANKYLGDGIAIRLKAEKKASIWAPVSGTLETVFPTKHAYGITTEE
GIKVLIHIGVDTVALNGEGFETKLKQGKKVKAGDLLCTVDVEYLSNQNKVSDVIVVILNE
SEHKHIIDTALGEKMTKRADKLMLVK
Download sequence
Identical sequences gi|308189622|ref|YP_003922553.1| gi|319776776|ref|YP_004136427.1| WP_013354310.1.1463 WP_013354310.1.78519 WP_013354310.1.95544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]