SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308189937|ref|YP_003922868.1| from Mycoplasma fermentans JER

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308189937|ref|YP_003922868.1|
Domain Number 1 Region: 51-122
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.00000000000811
Family Glucose permease domain IIB 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308189937|ref|YP_003922868.1|
Sequence length 124
Comment PTS system protein [Mycoplasma fermentans JER]
Sequence
MSKKDKFLVVLLTIVTLGFCWLYWHLKNKKEQKIKKEGVNIKLPSNIKVVELVDNLGGKE
NIEEVNASISNIKVLIKDKTLIKMDKLQDTKFITGIMISTNKISLVIGDYARKLALEMNE
YLEK
Download sequence
Identical sequences gi|308189937|ref|YP_003922868.1| WP_013354625.1.1463 WP_013354625.1.78519 WP_013354625.1.95544 gi|319777217|ref|YP_004136868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]