SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308189791|ref|YP_003922722.1| from Mycoplasma fermentans JER

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308189791|ref|YP_003922722.1|
Domain Number 1 Region: 134-269
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 9.94e-37
Family Glucose permease-like 0.0001
Further Details:      
 
Domain Number 2 Region: 32-98
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.0000000000000523
Family Glucose permease domain IIB 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308189791|ref|YP_003922722.1|
Sequence length 294
Comment hypothetical protein MFE_02260 [Mycoplasma fermentans JER]
Sequence
MGFVSWIKRVFGRKDNKQKIKEVRKLVEISQLTRDIVNAMGGIENITGFNNCAVRLRYDV
KDTSLVNEEALKKVGASEVIFIGKRHVQAKFGEISEKLNLDIQEAAPFLEEEALKNKKIE
VKSDVNLFEEKPVEVKKTVDENIVYTPCKGTRKSIEDLSDQTFSLLGCGYAIEIDKKLNK
LEVYAPINGKLIMSYPTKHAYGIANDNGLEVLVHIGIDTVKLNGLGFETNLKQNDKVERG
QLLATVDLKKLRNSKICSDVIVLITDNVNKNKQTKLLCPLEIKEVNVPWFKMVD
Download sequence
Identical sequences C4XEK9
gi|479133555|ref|YP_007761975.1| gi|308189791|ref|YP_003922722.1| WP_013354479.1.1463 WP_013354479.1.78519 WP_013354479.1.95544 gi|319777008|ref|YP_004136659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]