SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|305664916|ref|YP_003861203.1| from Maribacter sp. HTCC2170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305664916|ref|YP_003861203.1|
Domain Number 1 Region: 34-230,269-295,352-394
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.85e-71
Family Type II chitinase 0.0000605
Further Details:      
 
Domain Number 2 Region: 289-354
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000705
Family Chitinase insertion domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305664916|ref|YP_003861203.1|
Sequence length 402
Comment chitinase A1 [Maribacter sp. HTCC2170]
Sequence
MKIVKILGFLFLGIALVSFTFNLDFDKTVEESTTVVMAYYVPEKEYAPEKLPLGQLTHII
FSFTNVIDGEMKFRHEENGGKLKQLVAQRKSHPDLKVMIACGGWGADGFSDMAHTAENRK
KFVESVVAFNAKYELDGLDMDWEYPAIPAAGTGARPEDKENFTLLMKELREGLNTLKRVQ
TLTFASAGWERYYKNVEINEVMKHVDYMNVMTYDQIGSTSPFTGHHTALGLIKLEHIQGT
PAWDFLESRKEEMKKRGYTFKPRSVKSIVDFCIGQGVDPKQIVIGSAFYGRAWKGVPPKD
NGLYQENSGSHIGWSGYSQIRKEFEVNKNYKRYWDPVAEAPYLYSAKDSIFISYDDTVSV
RLKTEYALKKKLGGIMFWQLGNDTKEVNSLLKSMYDASVKGL
Download sequence
Identical sequences A4AVQ6
WP_013304972.1.69417 gi|305664916|ref|YP_003861203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]