SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|514411069|ref|YP_008134510.1| from Pseudomonas aeruginosa RP73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|514411069|ref|YP_008134510.1|
Domain Number 1 Region: 508-608
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000747
Family Histidine kinase 0.024
Further Details:      
 
Domain Number 2 Region: 193-242
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000106
Family HAMP domain 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|514411069|ref|YP_008134510.1|
Domain Number - Region: 252-393
Classification Level Classification E-value
Superfamily GAF domain-like 0.000883
Family GAF domain 0.025
Further Details:      
 
Domain Number - Region: 88-132
Classification Level Classification E-value
Superfamily FlgN-like 0.0745
Family FlgN-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|514411069|ref|YP_008134510.1|
Sequence length 622
Comment ATPase [Pseudomonas aeruginosa RP73]
Sequence
MNKATAPDADQRDRFFGGSDRAGKPILRRSLVVRFGCYLTLLVSLALIGMFSALLFADYT
HQDAAVINHAGSLRMLTYRVALEPSLEGRQALLGTLGERLDSGDIRRLLQRQDADDPIRQ
LHQELREGLARLDPRALPGRAVLDAYVGDIDRFVGILQAKAERRSQLLSTVQGLCLFLSL
LVVFVTLYDLSYHVIGPLRELTSTARRLGRGELDARVTYSGEDELAQLGERFNQMAGELK
SIYGDLEERVEDKTRALSQSHQRLELLYASARRLGENPYDSRTLQPLLNQLEKVLDAGRV
TLCLNKDGVERAYSSLTTTERPADFCLQGDCGSCREQASACDQPSSLAQPLLMQPLSIAG
HRFGELFIESRSGRLENWQQQLIETFCDNIARTFALSLQQEQESRLALFAERGTIARELH
DSLAQSLSYLKIQVSRLGTLLKREAPAEKIEDTLDELREGLNGAYRQLRELLTTFRLSLD
EPSLEAALGNAVAEFGERGEVTIELDNRLQHVPLSPNEEIHVLQIVREALSNVVRHSQAQ
RAWVRLSSQADGQVSIAVEDDGVGFDPQQNRSGHYGLTIMQERGQTLGSQLRFEARAPHG
TRVLFSFVPTALQPSPAKEPTP
Download sequence
Identical sequences WP_016562237.1.12797 WP_016562237.1.20342 WP_016562237.1.32869 WP_016562237.1.3653 WP_016562237.1.39811 WP_016562237.1.42952 WP_016562237.1.53070 WP_016562237.1.5427 WP_016562237.1.64433 gi|514411069|ref|YP_008134510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]