SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|514408383|ref|YP_008131285.1| from Pseudomonas aeruginosa RP73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|514408383|ref|YP_008131285.1|
Domain Number 1 Region: 26-210
Classification Level Classification E-value
Superfamily E set domains 1.01e-54
Family E-set domains of sugar-utilizing enzymes 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|514408383|ref|YP_008131285.1|
Sequence length 389
Comment chitin-binding protein [Pseudomonas aeruginosa RP73]
Sequence
MKHYSATLALLPLTLALFLPQAAHAHGSMETPPSRVYGCFLEGPENPKSAACKAAVAAGG
TQALYDWNGVNQGNANGNHQAVVPDGQLCGAGKALFKGLNLARSDWPSTAIAPDASGNFQ
FVYKASAPHATRYFDFYITKDGYNPEKPLAWSDLEPAPFCSITSVKLENGTYRMNCPLPQ
GKTGKHVIYNVWQRSDSPEAFYACIDVSFSGAVANPWQALGNLRAQQDLPAGATVTLRLF
DAQGRDAQRHSLTLAQGTNGAKQWPLALAQKVNQDSTLVNVGVLDAYGAVSPVASSQDNQ
VYVRQAGYRFQVDIELPVEGGGEQPGGDGKVDFDYPQGLQQYDAGTVVRGADGKRYQCKP
YPNSGWCKGWDLYYAPGKGMAWQDAWTLL
Download sequence
Identical sequences gi|558676621|ref|YP_008813329.1| WP_003145647.1.101871 WP_003145647.1.10257 WP_003145647.1.13315 WP_003145647.1.20342 WP_003145647.1.21718 WP_003145647.1.21744 WP_003145647.1.22324 WP_003145647.1.23331 WP_003145647.1.23794 WP_003145647.1.2927 WP_003145647.1.2948 WP_003145647.1.30994 WP_003145647.1.32596 WP_003145647.1.32869 WP_003145647.1.34317 WP_003145647.1.34401 WP_003145647.1.35599 WP_003145647.1.3653 WP_003145647.1.37366 WP_003145647.1.39345 WP_003145647.1.39811 WP_003145647.1.42634 WP_003145647.1.42952 WP_003145647.1.44373 WP_003145647.1.445 WP_003145647.1.48094 WP_003145647.1.49500 WP_003145647.1.49557 WP_003145647.1.50668 WP_003145647.1.5226 WP_003145647.1.5427 WP_003145647.1.58056 WP_003145647.1.59250 WP_003145647.1.60639 WP_003145647.1.64433 WP_003145647.1.70331 WP_003145647.1.71385 WP_003145647.1.74072 WP_003145647.1.76791 WP_003145647.1.8110 WP_003145647.1.81331 WP_003145647.1.82260 WP_003145647.1.83025 WP_003145647.1.84174 WP_003145647.1.86047 WP_003145647.1.88517 WP_003145647.1.88578 WP_003145647.1.89868 WP_003145647.1.90655 WP_003145647.1.91860 WP_003145647.1.94031 WP_003145647.1.95132 WP_003145647.1.96434 WP_003145647.1.97126 gi|558670270|ref|YP_008806980.1| gi|514408383|ref|YP_008131285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]