SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332299778|ref|YP_004441699.1| from Porphyromonas asaccharolytica DSM 20707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332299778|ref|YP_004441699.1|
Domain Number 1 Region: 227-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-28
Family ABC transporter ATPase domain-like 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|332299778|ref|YP_004441699.1|
Domain Number - Region: 146-224
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000445
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332299778|ref|YP_004441699.1|
Sequence length 467
Comment DNA mismatch repair protein MutS domain-containing protein [Porphyromonas asaccharolytica DSM 20707]
Sequence
MKDLRSCIDQISGVRYVVEEMHFNSSPGRMAMLATLWSSEVETIEQRLDEVARYIAYLSD
HEQQKGMQEVALHLCDLMNVSGSIETIRQPQVICSDIDLFEIKRLALIEEKVRRLAEQYH
LEILQCHTLTEVVDILDIDGERLPSFYISDSYSAVLRSLRKQMERTSEETERDELAVQCA
IEEDRVRKRLTEALHPYADQIEEALEALAQIDKLHAIAQWALAHGCCRPKPMRSGESNLT
DLIHPEVAHHLAERQDRFQPVTISYTDQPTLITGANMAGKSVLLASIGLAQCLMQFGCYV
TARQAQLVPVDEVIFSIGDDQNIKSGLSSYGAEMLRLNRIIESVKEGKQVLALIDEPART
TNPEEGHALVSALVQLFAQYAVRAIITTHYSGILGRCHRWRVRGFVEERLRQPLEINQLN
RCIDYSLIHDTQTDAPHEALRIAEILGMDRELLDLCEKNLATKNEDK
Download sequence
Identical sequences F4KNX3
gi|332299778|ref|YP_004441699.1| WP_013760115.1.45769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]