SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332299823|ref|YP_004441744.1| from Porphyromonas asaccharolytica DSM 20707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332299823|ref|YP_004441744.1|
Domain Number 1 Region: 272-569
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.14e-78
Family DNA repair protein MutS, domain III 0.00000253
Further Details:      
 
Domain Number 2 Region: 571-806
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-56
Family ABC transporter ATPase domain-like 0.00000121
Further Details:      
 
Domain Number 3 Region: 6-114
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.62e-39
Family DNA repair protein MutS, domain I 0.0000362
Further Details:      
 
Domain Number 4 Region: 115-271
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.7e-36
Family DNA repair protein MutS, domain II 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332299823|ref|YP_004441744.1|
Sequence length 874
Comment DNA mismatch repair protein mutS [Porphyromonas asaccharolytica DSM 20707]
Sequence
MAKKEIAETPMMRQYLQFKKKHPDAILLFRVGDFYETFSDDAIEASKILGITLTKRANGA
AQHVELAGFPHHALDTYLPKLVRAGKRVAICDQLEDPKLTNKLVKRGITEIVTPGVVTTD
NVLQSKQNNFLAAVYPQAKGENRYGLALLDLSTGEFYASECTDQVLAKLVSGYNPKEILI
ERKHRDHLQRLLQPEGHLSDYDDWIFSESNNRERLLQHFGTLSLKGFGIDTLPLAITAAG
AVLHYLDMTKHTEIGHITRIVRIDEQRHVRIDGFTAHSLELTTPMNAGGTTLRQILDQTV
TPMGARLLDQWIAFPLKELQAIQQRQSIVANLVDNPQLRTQLTDQMKEIGDLQRLVGRVA
MGRITPREVVRLGLSITLIAPIRQLALDEGEETLTALCSLLDPCAQLCQQITFQLNPEAP
QQIGKGETIAEGFCEELDQLRRLLKSGKQYLDDLLARETEHTGISSLKIGFNNVFGYYLE
VRNTYKEQVPEEWIRKQTLVSAERYITQELKEYEEKILGAEDRILALEQELFAKLIGTLQ
QFANQLLQDAQILAQLDVLASLAAVAKAYDYCRPTLNEGYDLEIVDGRHPVIERTLPAGQ
PYIPNDVRLSPIDCQIMIITGPNMSGKSALLRQTALIVIMAQMGSFVPATSATIGIVDSV
YTRVGASDNIAVGESTFMVEMQEAASILNNLTPRSLILFDELGRGTSTFDGVSIAWAIVE
YLHSTTQGRAKTLFATHYHELNELADHLERVQCYNVSAREIDGEMLFLRKLVPGGSAHSF
GIQVAKLAGMPTWIVARAGEVLQHLEAYRTESDQAPDSATPSTSQSGGMQMSIFQLDDPV
LTAVRTKINELDINNLTPLDALKQLDALKQMLNN
Download sequence
Identical sequences F4KJD3
WP_013760146.1.45769 gi|332299823|ref|YP_004441744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]