SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332300053|ref|YP_004441974.1| from Porphyromonas asaccharolytica DSM 20707

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332300053|ref|YP_004441974.1|
Domain Number - Region: 8-70
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 0.00719
Family DNA repair protein MutS, domain I 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332300053|ref|YP_004441974.1|
Sequence length 228
Comment hypothetical protein Poras_0863 [Porphyromonas asaccharolytica DSM 20707]
Sequence
MLTIRDILQQEQTNRAHIYLYRRGLFYQAFNYSAYLLYHLVYPFEVTSLRNTRINKRYYM
VSFPVQLLSSSSAKAKCDALADSQVLRYTPSRSAKATLTESYDEWCLRYTPVRGKGAATT
PPTSPTSPTSPTQGEGDAPKASTVNSSQELGVCSNLSELLQDLEQESEQEFLSMIAKSVS
YELTLDDKASLCDWLVYCILKLPMQRLCPIAALDQLDKLQQELRQKLS
Download sequence
Identical sequences F4KK81
gi|332300053|ref|YP_004441974.1| WP_013760306.1.45769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]