SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332300100|ref|YP_004442021.1| from Porphyromonas asaccharolytica DSM 20707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332300100|ref|YP_004442021.1|
Domain Number 1 Region: 78-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000196
Family NfeD domain-like 0.006
Further Details:      
 
Weak hits

Sequence:  gi|332300100|ref|YP_004442021.1|
Domain Number - Region: 25-74
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0392
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332300100|ref|YP_004442021.1|
Sequence length 151
Comment hypothetical protein Poras_0910 [Porphyromonas asaccharolytica DSM 20707]
Sequence
MFNSPIYFWLIAGLLLLLVELLTPGFVVACFGIGALLAILPAALGASITWQVITFCIGSI
LALLLLRPMVCRLSRNKETARTGIEALYGRTARVTECIDASRETGRVAVDGDNWRARTVA
PDMVIPRGEMVRIVSNDSIVMIVEPITETAE
Download sequence
Identical sequences F4KKC8
gi|332300100|ref|YP_004442021.1| WP_013760342.1.45769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]