SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327402768|ref|YP_004343606.1| from Fluviicola taffensis DSM 16823

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327402768|ref|YP_004343606.1|
Domain Number 1 Region: 83-180
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.72e-31
Family Ribosomal protein L6 0.00012
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.22e-24
Family Ribosomal protein L6 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327402768|ref|YP_004343606.1|
Sequence length 184
Comment 50S ribosomal protein L6P [Fluviicola taffensis DSM 16823]
Sequence
MSRIGKSPVTIPSGVEVKVNGTTVTVKGSKGELTQEIDSCITIQIEGSEITFIRASDAPD
HRAKHGLYRALLFNMCAGVSEGFKKELEVIGVGYRATATGQQLELALGYSHPIVIELPKE
IKVSADTQKGKAPLVTLESYDKQLLGQVAAKIRSLRKPEPYKGKGIRFLGEEIRRKAGKS
AGKK
Download sequence
Identical sequences F2IIR1
gi|327402768|ref|YP_004343606.1| WP_013685540.1.50955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]