SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327405890|ref|YP_004346728.1| from Fluviicola taffensis DSM 16823

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327405890|ref|YP_004346728.1|
Domain Number 1 Region: 129-289
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.26e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 408-569
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 20-128
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.32e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0094
Further Details:      
 
Domain Number 4 Region: 264-287,317-419
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.49e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327405890|ref|YP_004346728.1|
Sequence length 703
Comment Ferredoxin--nitrite reductase [Fluviicola taffensis DSM 16823]
Sequence
MESFRTEYELQVEAKKLRVEKDILELGDKIAAFKDGKIPDDKFRSLRLARGVYGQRQLGV
QMIRIKLPYGKLSSNQLRRIAQVSDEYSTGRLHITTRQDIQIHHVSLDRTPQLWSDLEKD
DVTLREACGNTVRNVTASDNAGINPNELFDVTPYAEQVFQYFLRKPFGQELGRKIKIAFS
SDDQDDAFTFIHDFGFIPRIKLQGKLQVKGFKVLIGGGLGAQPFLAHVAYEFLSESEIIP
FIEASIRIFDRYGERNSRNKARMKYLISKIGLETFLELVGKEKEAVQFDLNRDQVKPLTE
FEYEEQTAVERDDLYTSDLVYNQWIRTNVFLQKQPGYLAVFVKVPLGDFYTDQARSLAYL
LDSLNLPELRFTINQNIQIRGVKPEQLSPIYLQLEQLNLIGSGYGGLTDITACPGTDTCN
LGISNSTNVALELESFIRTNYPKLIEETGIRIKISGCMNSCGQHGLAHIGFHGSSIKTKE
GTLPALQVLLGGGQTGAGTGRIAEKVIKVPSKRILKVVQSILDDYLQFHENDEAFNAYYD
KQGNTYFYNLLKPLTDLNQVELEEYLDWGQNERFATAIGVGECAGVIIDLVGTLFFDAEE
KLFSAQEAWIENRYADSIYYGYAAAVHSAKAKLIEKGIRCNSQHGILTDFDTHLGADFGY
SDSNLFSDFVLRINKEKASKVFAKAYLNEIEELITKLKVKNEY
Download sequence
Identical sequences F2IHT1
gi|327405890|ref|YP_004346728.1| WP_013688648.1.50955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]