SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327402785|ref|YP_004343623.1| from Fluviicola taffensis DSM 16823

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327402785|ref|YP_004343623.1|
Domain Number 1 Region: 4-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-98
Family G proteins 0.0000000662
Further Details:      
 
Domain Number 2 Region: 267-406
Classification Level Classification E-value
Superfamily Translation proteins 5.05e-35
Family Elongation factors 0.0000888
Further Details:      
 
Domain Number 3 Region: 481-603
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.56e-34
Family Translational machinery components 0.0000646
Further Details:      
 
Domain Number 4 Region: 607-694
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.3e-28
Family EF-G/eEF-2 domains III and V 0.00018
Further Details:      
 
Domain Number 5 Region: 404-482
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.31e-25
Family EF-G/eEF-2 domains III and V 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327402785|ref|YP_004343623.1|
Sequence length 701
Comment translation elongation factor 2 (EF-2/EF-G) [Fluviicola taffensis DSM 16823]
Sequence
MARDLKFTRNIGIAAHIDAGKTTTTERILYYSGVNHKIGEVHDGGATMDWMEQEQERGIT
ITSAATTVNWKYRNQNYHINIIDTPGHVDFTVEVNRSLRVLDGLVFLFSAVDGVEPQSET
NWRLANNYNVPRIGFVNKMDRQGADFLNVCAQVKEMLGSHALPLQINIGDEDNFRGVVDL
INFKGIEWNEHDMGMTFQEVEIPADIVDEARRLRSELLEAVAEFDETLMEKFFEDENSLT
EREILNALRAATISGKVVPMMCGSSFKNKGVQAMLDMVMEILPSPLDNGSIVGINPKTDE
EEERLPSYDAPFAALAFKIATDPFVGRLCFIRAYSGKLPAGSYVYNTRSENKERISRIFQ
MHANKQNQIDELGAGDIGAVVGFKDIRTGDTLCAEGHPIILESMNFPDPVIGIAIEPKTQ
ADADRLSNGLNKLAEEDPTFRVNTDEESGQTIISGMGELHLDIIVDRLRREFKVEVNQGA
PQVTYREDITVAIDHREQYKKQSGGRGKFADIAVKIGPQTDPEKTGLEFVNSIKGGNIPR
EFIPSVEKGFKESMKNGVLAGFPVEAMKVELVDGSFHAVDSDSLSFEMAAKMAYRHALKN
CKPILLEPIMKLEVICPEENMGDIVGDLNRRRGMMKGMDDKAGGKVVRADVPLSEMFGYV
TQLRTLSSGRATSSMEFSHYAEAPKNVAEEVIAKINGKVSA
Download sequence
Identical sequences F2IIS8
WP_013685557.1.50955 gi|327402785|ref|YP_004343623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]