SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325954049|ref|YP_004237709.1| from Weeksella virosa DSM 16922

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325954049|ref|YP_004237709.1|
Domain Number 1 Region: 214-408
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.7e-63
Family B3/B4 domain of PheRS, PheT 0.00000943
Further Details:      
 
Domain Number 2 Region: 44-204
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.85e-43
Family Myf domain 0.0049
Further Details:      
 
Domain Number 3 Region: 482-701
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.47e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00048
Further Details:      
 
Domain Number 4 Region: 710-809
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.35e-26
Family Anticodon-binding domain of PheRS 0.00096
Further Details:      
 
Domain Number 5 Region: 418-490
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.66e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325954049|ref|YP_004237709.1|
Sequence length 809
Comment phenylalanyl-tRNA synthetase subunit beta [Weeksella virosa DSM 16922]
Sequence
MNISYNWLRKYINTPISVDELSAILTNIGLEVEGVEKIGGNKDYLDKVIIGEVVSVEKHN
NADKLKVTQINFGNGEPVQIVCGAPNVAIGQKVAVATEGTQLPTKEGESFTIKKAKIRGE
ESNGMICSEVELGIGEDNSGILVLPKNYQIGESILEYISIDEDYLIEIGLTPNRADAMSH
YGVARDLFAALKVRGYEAEFTPYDLSQYPTENFGKNPIKSNIKNTEAAPRYASVYLKNIH
VQPSPEWLQTALRTIGLTPVNNVVDIANFVMHDLGQPLHTFDADKISGQEVVVEIANKDT
KFTTLDGIERTLKGHELMISDTEKPMCIAGVFGGKNSGVTNETTSLFVESAYFDPVTIRK
GAKAHALNTDASFRFERGIDPTLTIDALKKAVLLLVEYANAEIASDIDDFYPKVIEDFPI
TLRYKKINQLLGMEIPKEKIKEIFTYLEIKTIKENDEEVEVLVPAYRVDVHREVDLIEEI
LRLYGYDNITEPEKVSFSIIPSNKTNPEKVEDFVARELNAFGFHEAMNNSLIKKEYEELF
HFPDGEFVEMLNPLSADLAVMRRSLITGLLENVIFNVNRKNKNIKLYEFGKIYTKLNNTY
QESKQLSLVVSGDIGGENWTKNQRKASFYDLKGVINQLFERLGLRIDSESPTEDANLQEG
IRLITNGKVLGYAGIVNQKLLKKIDLNQAVYYAQLDWDVLLSMVNQQPLKYKEIPKFPGS
RRDLALLLPQTTTYQELYNAAFGLKNELLKDVHLFDVYEGDKLPVGNKKSYALSFFFRDN
QKTLSDDEVDRVMKKLIHLYEKSFGASLR
Download sequence
Identical sequences F0NYL1
gi|325954049|ref|YP_004237709.1| WP_013597523.1.86615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]