SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325954107|ref|YP_004237767.1| from Weeksella virosa DSM 16922

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325954107|ref|YP_004237767.1|
Domain Number 1 Region: 35-279,438-483
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.76e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 526-670
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 2.62e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00064
Further Details:      
 
Domain Number 3 Region: 263-363,390-435
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.59e-29
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325954107|ref|YP_004237767.1|
Sequence length 671
Comment succinate dehydrogenase or fumarate reductase, flavoprotein subunit [Weeksella virosa DSM 16922]
Sequence
MSTLLNSKTPTGDIATRWERHKANLRLVAPNNRDRLEIIVVGTGLAGGSAAATFAELGYK
VKAFCYQDSPRRAHSIAAQGGVNAAKNYKGDNDSIFRLFYDTIKGGDYRARESNVHRLAE
VSGNIIDQCVAQGVPFARDYGGYLDNRSFGGVQVSRTFYAKGQTGQQLLLGAYSAMNHQI
HLGHIDMYNRHEMLDIVLVDGKARGIIARNMITGEIERHSAHAVIIATGGYGNVYFLSSN
AMGSNVTAAWKIHKKGAYFANPCYVQIHPTCIPIHGTNQSKLTLMSESLRNSGRIWVPKK
KEDSEAIRAGKKKAVDIKEEDRDYYLERRYPAFGNLVPRDVASRAAKERCDAGYGIEANE
TGEGVFLDFSTEIIKRGREVAFANGNTNPSDAEIDQLGKKWLEEKYGNLFQMYQKITDVN
PYENPMHIYPAIHYTMGGIWVDYNLMSTIPGCYVAGEANFSDHGANRLGASALMQGLADG
YFVLPYTVADYLADDIRTGKISTNTPEFEEAEKAVKERLDFFVNNKGTKSVDHFHKRLGL
IMWNKVGMARNAKGLQEAIVEIEALRKEFWKDVRVPGRVDELNPELEKACRVADFLELGQ
LMAIDALHRNESCGGHFREEYQTEEGEALRDDENFAYVAAWEYKGDDINQEVLHKEDLHF
EFIELKTRSYK
Download sequence
Identical sequences F0NYY7
gi|325954107|ref|YP_004237767.1| WP_013597581.1.43610 WP_013597581.1.86615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]