SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118575254|ref|YP_874997.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575254|ref|YP_874997.1|
Domain Number 1 Region: 65-176
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000794
Family Integrin A (or I) domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118575254|ref|YP_874997.1|
Sequence length 276
Comment hypothetical protein CENSYa_0044 [Cenarchaeum symbiosum A]
Sequence
MVRRIEFRTKGLVWGMGSGRYRSRFRGGGTDLAELREYVPGDDTRRIDWNASARHGSIYT
RELAEERELAVHVSVDVSGSISCGMAKQERMLEVAASIMYSAEQSGDRIGMSIFTDCIEG
FIPPGRGRAHLLRLFGSLARHKPRSSCTDLSASLLGLGSALRGRSLVFVISDFASDPFAE
QLGRLSAVHDVILVRVTSSIEAEIPDAGQVIFVDAENNEQMAIDTSDIHFRAEYARLAKE
RGAELARDARRSGAGLIDVGPTEPFEAAFLRHFGRR
Download sequence
Identical sequences A0RTM6
gi|118575254|ref|YP_874997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]