SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118575407|ref|YP_875150.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575407|ref|YP_875150.1|
Domain Number 1 Region: 96-263
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.76e-37
Family Aminoacid dehydrogenase-like, C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 8.06e-30
Family Shikimate dehydrogenase-like 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118575407|ref|YP_875150.1|
Sequence length 268
Comment shikimate 5-dehydrogenase [Cenarchaeum symbiosum A]
Sequence
MIGDPINHSLSPTLHNAAFMELGMDCTYIAYRIPRGELEEGIGSLKDTGVEGFNVTIPHK
VAVMKYMDRLDETCSMAGAANTVSIKDGVLKGYNTDMGGFLDPIKKRGIGIEGTEALVLG
AGGAARAVTVALAGEGARRITIANRTQQGAREIALLARRLGADAVPADLEDVGRLARRSK
FIVNCTPVGMGGEPSLVPEESIQDTSVVYDIVYMPLETDMIKKAKARNAVYIRGFEMLLG
QACRAFEIWHEVEAPYKAMKQMMVGDLA
Download sequence
Identical sequences A0RU29
gi|118575407|ref|YP_875150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]