SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118575416|ref|YP_875159.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575416|ref|YP_875159.1|
Domain Number 1 Region: 4-355
Classification Level Classification E-value
Superfamily Chorismate synthase, AroC 1.31e-126
Family Chorismate synthase, AroC 0.0000000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118575416|ref|YP_875159.1|
Sequence length 363
Comment chorismate synthase [Cenarchaeum symbiosum A]
Sequence
MPGSSIGERLVLTSFGESHGRCVGAVLDGCPAGLELSERDIQYMLDQRRPGQSSITTQRK
EADRVEIISGVFRGHTTGAPIATVIWNTDQKSEAYDELEHVPRPGHSDYPAMIKYGKFND
HRGGGRFSGRLTATHVMGGAIARKLLEKALKVRTISYVTSIGKVSVQVKPPKTSKPVYSN
DVRCPDAAAAARMRKAIVSAKTGGDSLGGIIESVTTGLPVGLGEPVFGSLESDLSRAIYS
IPSVKGVEFGSGFAGAASTGSENNDPFRIKSGKITTITNNSGGILGGLSIGTPITMRVAF
KPVSSIPQKQSTVDTKANKPAVLRVKGRHDPCVVPRAPPVVDALVSLVIADHAIQGGFIR
GVL
Download sequence
Identical sequences A0RU38
gi|118575416|ref|YP_875159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]