SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118575987|ref|YP_875730.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|118575987|ref|YP_875730.1|
Domain Number - Region: 349-427
Classification Level Classification E-value
Superfamily QueA-like 0.0366
Family QueA-like 0.0081
Further Details:      
 
Domain Number - Region: 554-617
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 0.0942
Family Transthyretin (synonym: prealbumin) 0.022
Further Details:      
 
Domain Number - Region: 162-223
Classification Level Classification E-value
Superfamily E set domains 0.098
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118575987|ref|YP_875730.1|
Sequence length 710
Comment hypothetical protein CENSYa_0793 [Cenarchaeum symbiosum A]
Sequence
MARILAAAALILLAAGLHGAYGEIGVSTDGFGRSTIMQFENTGSPPVEAFRLWLPPGVQF
NSFKAPDGWTGTSSPQGLLVFRADLPLESGEIAKFGLVTNIEEPGINWKALGADEAELGL
GKILVSEPPPEPVPAPVVSEPVEEPEPVDEPDPGVLPGSAFRFIPEKPSVGSTVRVTGAG
FGSGQELGLFMGESRLDTFSTDESGTFVITSKIPAGTAADRVDFAVRDGTGGEKTFSLRL
ADAPVAQPGEEEIVFTVGNIPAVVNPGDVVTVGGTGAPGGSLTATVKAPPTDEFPEGETL
NTASARINLDGTWSHEAVVPIDAVFGRYHAEITDGKNTVEKTWTVESDEHIRIEPIKQRF
EPGEELVFNGTAIAGSDLEAVLENPQGAEISAKTVSVDSSGFVQVNFSTSSAYPEGTYVM
YAAQGDHRAIVPVGLGQLPMEQILFTMDKLNYVAGDVARLAITGAQSSTVSLVILDPSDQ
EYHTNPRIFLGSNGKVEHPLDLDGYKSGVFSVVLQRGDSQAKGSFSVGLQTGSGPIKVQT
VKSEYAPGDPILVLGESGANILIILDLIDPSGTIVKTREAFTDKNGKINEDEFRVPADAA
LGEWKVIAKSGPNFGEAPFEVKADIEDGMVIAVEEIKDIAGRDHAYARIYGAQSSITILV
YSAGEEIATIKPQGRADPHEALWPVPGPGTYTLAASDGKNNANTTFTYDG
Download sequence
Identical sequences A0RVQ9
gi|118575987|ref|YP_875730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]