SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118576326|ref|YP_876069.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|118576326|ref|YP_876069.1|
Domain Number - Region: 102-193
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0141
Family Nuclease 0.04
Further Details:      
 
Domain Number - Region: 71-96
Classification Level Classification E-value
Superfamily Phage tail proteins 0.0646
Family Baseplate protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118576326|ref|YP_876069.1|
Sequence length 219
Comment DNA repair helicase [Cenarchaeum symbiosum A]
Sequence
MGLRDISIKEEYRSDRDDIVSEFFIPCLSNCIEYDRCIEYISLKSLTTLSMSFDNFTKKK
AKLRIICGHRFNVSDLEFISRIFSEEGRSFRLGHSDIRDAKIKMLQEVVSNHQIDVKIAI
PNSEEVVGSFSERVGIFIDEHDDVVAFTGTSNQTFNIHDRNFESVDVFTSWNDRSRVDTK
VRNFEALWENRTKYVEVYDFHQAERGHMLKYSSEWAIEQ
Download sequence
Identical sequences A0RWP8
gi|118576326|ref|YP_876069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]