SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118576474|ref|YP_876217.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576474|ref|YP_876217.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 2.75e-41
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0000732
Further Details:      
 
Domain Number 2 Region: 135-264
Classification Level Classification E-value
Superfamily Translational machinery components 9.16e-34
Family ERF1/Dom34 middle domain-like 0.00089
Further Details:      
 
Domain Number 3 Region: 266-409
Classification Level Classification E-value
Superfamily L30e-like 2.12e-21
Family ERF1/Dom34 C-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118576474|ref|YP_876217.1|
Sequence length 411
Comment peptide chain release factor 1 [Cenarchaeum symbiosum A]
Sequence
MYKIRKMLDELSGISGRGTELISVYIPKGKQLHEIISVLKEEQGTADNIKSDLTRTHVVD
SLAKVVQRLRLYKKTPERGLVIFCGALPPEGGGPTGSETVRAFEIDPPKELRTFLYRCDD
HFHVDILKGMLKDDNLIGFLAIDAKDAGWGLLRGDKVEVLAQTGSGVAGKHRQGGQSAKR
FQKLREMELTYYYNRVAGTTREYFIDIYPIKGLIVSGPGPTKEEFLNGSYLEYRLQEMVI
ATLDTSYSGSEGIRESFAKSASVLSDFRMVEEGALVEKLFREVNSHSGLGAYGFAEVSDL
LDRNVVETLLITDDANLHRVEAKCRRCGNVQDQTVEGPRVIPVRTGMLGAPCPSCNSTDL
EASQRDVVDYFGLVAAKNGAKIEVISGKAEHGMMLSSLGKVAAILRYNPGY
Download sequence
Identical sequences A0RX46
gi|118576474|ref|YP_876217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]