SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118576781|ref|YP_876524.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576781|ref|YP_876524.1|
Domain Number 1 Region: 245-584
Classification Level Classification E-value
Superfamily SIS domain 1.41e-82
Family double-SIS domain 0.00000568
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.18e-61
Family Class II glutamine amidotransferases 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118576781|ref|YP_876524.1|
Sequence length 585
Comment glucosamine 6-phosphate synthetase [Cenarchaeum symbiosum A]
Sequence
MCSIIGYRGDGPAAPVIVSGLKRMEYRGYDSVGVATQTGSGISLKKGVGRVAEVNQSAGL
DGMPGTIGIGHTRWATHGQVTDANAHPHACNSGAVAVVHNGTIENFEELKKGLSAAGYSF
TSETDTEVIANQLQKNYSAEEGAESALLKTLPELRGRYAFVAMFEDGTMVAARLHEPLIV
GVGEDSYFLSSDVLGFIERTDDAIYIDNGCFVVVDEKGMRISRFDGTPVRPQITKVSKEI
ADAYKGDYAHFTLKEISEQPDTILRCGGDGGAVEQMAGEIRRAGTAYITGSGTSYNAALV
ARHVMSKYADTRLEPIIASELPHSPFSAGEGSVFIAVSQSGESADVIDAAAIARDSGARI
VSIVNMRTSSLARESDVVVGMNCGPEIGVAATKSFTSQLGIIYKMADIIGGGRAGADFAA
VSKAISGILSDHAGIKKLAGELRDVTDMYVLGRGVHYPMAAEAALKLKELTYVHAEGIPG
GELKHGPLALMGPGVYAVIMNPADSTYEDTLTGAREIRARGAKIIGISDKNSDVYDHWVE
LPRVGESSYPLVEMVPVQLLAYYLALEKDTDPDHPRNLAKSVTVR
Download sequence
Identical sequences A0RY03
gi|118576781|ref|YP_876524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]