SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118576886|ref|YP_876629.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576886|ref|YP_876629.1|
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily AlbA-like 3.53e-18
Family DNA-binding protein AlbA 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118576886|ref|YP_876629.1|
Sequence length 96
Comment archaeal DNA-binding protein [Cenarchaeum symbiosum A]
Sequence
MSNETRDTIFIGKKPLMAYVTSTLIQLANLPTVSIKARGMSIGRAVDVAQIISRKTENAG
YKIGDIRIGSETLESNDGKTRNVSTIEIEVKRNVSQ
Download sequence
Identical sequences A0RYA8
gi|118576886|ref|YP_876629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]