SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118576969|ref|YP_876712.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576969|ref|YP_876712.1|
Domain Number 1 Region: 587-871
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.04e-36
Family SGL-like 0.01
Further Details:      
 
Domain Number 2 Region: 24-120
Classification Level Classification E-value
Superfamily E set domains 0.0000000511
Family Copper resistance protein C (CopC, PcoC) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118576969|ref|YP_876712.1|
Sequence length 927
Comment streptogramin lyase [Cenarchaeum symbiosum A]
Sequence
MIRMIKILAVLALISAAMVLPASAHPFTDETIPPQFSSAPVGTSEVVVSYSESVEISFSE
LRVFDSIGEQVDNGDTSYFEGDNSLVVTTGPLQEGVYTVTSKVLSRVDGHLVDYAFVFGV
GDVQIDRSAVEGATPTDLIFFPEAGARFPGLVGQTVVLGAAIASLFVWGTQRKDLIGEEL
GRFEKAFHGKFMTLVGAGLVAVFASNILMLTVQTLRLEASAFDALQTSFGMTWSIRMGIT
VALLGVWFAMERAGRLSPRGQAPLLVLALLLIATTTMMGHGTASGQPSAMALDYVHNLVS
SAWIGGIIFLAFALLPALRGLGDRAREGLSLAAMPRFSIMFIIAIGIVIITGPVLMWLLE
DDLGMIAGSTYGRLIVIKILLASAMIGIGWYHQFSIQKKAEKAIKSGAPDVNRKLGRSLR
AEVILGVALLGVVALLTNGTLPEGEVQTAEAQEVAYGLSTREFSGDARFDVEIYPFAPGV
NTITVLATGTAGDPIADLDTVKVKVGNPSRNIVPVIIPMEAAGESSVFQGEATFGFSGDW
QVEVEAKRTESANEGVTMDLLVKPRLENLRAEIVEYELPEAGAPLYPLYDGAGNIWISDS
SGPQLWRFSIADEEFTKYEFEGESSITLEADRGRVWFTDVPAGRIGYVDMQTGESEIVEL
PPLEPADAGSFPIAIDADADGNLWISIANKNVLLRYDPETGEFDVHELPTENSGPFAVAV
DDSGRVWFSQQTVGQIGYIDPESGEITEIAPPEPLSTPETITIGADGTLWIAEHQEGGGI
TRYDPVLGTFEKISAPDPAAFPNSAVFDRYRNVWFALHTVDKIAAYDPQRGGVIEVPVPT
AQSWAQFTTSDDKKNVWFVEQKPSKLATIKLTEVPAPAAAPQQEDVRGARYTEVASPLIA
LGIIAVSLFFVKGVKDKRRINGLVYGE
Download sequence
Identical sequences A0RYJ1
gi|118576969|ref|YP_876712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]