SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118577129|ref|YP_876872.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118577129|ref|YP_876872.1|
Domain Number 1 Region: 168-357
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.85e-58
Family Actin/HSP70 0.00000318
Further Details:      
 
Domain Number 2 Region: 364-517
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 7.06e-58
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000029
Further Details:      
 
Domain Number 3 Region: 2-163
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.47e-49
Family Actin/HSP70 0.00000607
Further Details:      
 
Domain Number 4 Region: 511-587
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000392
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118577129|ref|YP_876872.1|
Sequence length 656
Comment molecular chaperone [Cenarchaeum symbiosum A]
Sequence
MAKVIGIDLGTSNSAAAVVMGGKPTIIPAAEGATVGGKAFPSVVAFSKDGDLLVGEPARR
QAVTNPENTIMAAKRKMGSEHIFKAGGKDYKPQQISSFILQKIKKDAEAFVGEPVGQAVI
TVPAYFDDNQRQATKDAGTIAGLDVVRIINEPTAASLAFGLDKSKQDMKILVFDFGGGTL
DVTVMEMGGGVFEVMSTSGDTQLGGTDMDKAIIDYIVDDFRKREGVDLSQDSTALTRVRE
AAEKAKIELSTVMETDVNLPFISHDSSGPKNLELRLTRAKLEELVGPIIDRCRPSIEKAL
ADAKVSPSDIAKIVMVGGPTRMPAVKKFVSSVTGKESESGVDPMEAVAMGAAIQAGIIAG
DVTSDIVLLDVTPLTLGIDTLGGVREPLIERNTTIPTSKSKVFTTAVDNQTAVTIHVVQG
ERPMTSDNVSLGSFNLTDLPPAPRGIPQIEVKFDIDANGIINVTAKDLGTQKEAKITIES
SSKLSKDEIEKLREDAEKFSDEDEKKKGKVELKNEAESFVYTAEKLINHDLKDKITQEQG
IKISDGIREVKEALDQDPDILRPKLDSLKAMVNEITTEMYQQAAAQGAAGGAAGGAAGGA
AGGAAGDAAGAAGDSTGDAAGAAGGPSEGPAGDAGAGESAGPEPGDDGQPKPGPAA
Download sequence
Identical sequences A0RZ01
gi|118577129|ref|YP_876872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]