SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378720987|ref|YP_005285874.1| from Rickettsia rickettsii str. Colombia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378720987|ref|YP_005285874.1|
Domain Number 1 Region: 415-647
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 7.32e-74
Family Type II DNA topoisomerase 0.00067
Further Details:      
 
Domain Number 2 Region: 20-223
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.86e-55
Family DNA gyrase/MutL, N-terminal domain 0.00000541
Further Details:      
 
Domain Number 3 Region: 242-412
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.65e-38
Family DNA gyrase/MutL, second domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378720987|ref|YP_005285874.1|
Sequence length 662
Comment DNA topoisomerase IV subunit B [Rickettsia rickettsii str. Colombia]
Sequence
MSDLFSFNKEKKNKLVDNNYSAKDIEVLEGLEPVRKRPGMYIGGTDSNAMHHLVSEVLDN
AMDEAVAGFASIITIKMHHDHSITIFDNGRGIPIDNHPKFPDKSALEVILTTLHSGGKFS
NNVYHTAGGLHGVGISVVNALSKHLEIKVYKQGKLYSQSYSKGEKLTDLICEEASTRLRG
TSINFTPDPEIFSETLHFNPKKIYELARSKAYLYRGVTIEWVCEVEVQSDIPKKALISFP
NGLKDYLSSKITLDNLVIPGIFAGNIESTSDRIKLEWAICWQNNDSSAFVQSYCNTVPTP
QGGTHEQGLKSAILRGLKAYGEMIGNKKAANLTIEDILETTSVVLSIFIAEPSFQGQTKE
KLVSNGVSKPVENIIKDHFDHFLSSDKALATNLLEHVISIAEFRISKKNEKNISRKNATQ
KLRLPGKLADCTRTSPEGTELFIVEGDSAGGSAKQARNRETQAVLPLWGKVLNVASSTLE
KIVNNQAIQDLEIALACGSLKNYKKENLRYEKIIIMTDADVDGAHIASLLMTFFFLRMPK
LVEEGHLYLAKPPLYRLTQSNKTYYAGDEEEKAKLTDKLLKASKAKIEVGRFKGLGEMMP
AQLKETTMHPEKRSLLKVTLEDVQNVDKIVDDLMGKKPEKRFQFIYEQALVKMDKIISEL
DI
Download sequence
Identical sequences A0A0H3AXB6 B0BWP4
gi|379017486|ref|YP_005293721.1| gi|165932887|ref|YP_001649676.1| 392021.A1G_01765 452659.RrIowa_0374 gi|378722340|ref|YP_005287226.1| gi|157828185|ref|YP_001494427.1| gi|378720987|ref|YP_005285874.1| gi|379016750|ref|YP_005292985.1| gi|378723697|ref|YP_005288581.1| WP_012150523.1.17801 WP_012150523.1.31136 WP_012150523.1.3339 WP_012150523.1.38731 WP_012150523.1.4490 WP_012150523.1.74071 WP_012150523.1.77680 WP_012150523.1.78650 WP_012150523.1.81845 WP_012150523.1.83836 WP_012150523.1.89241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]