SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378721087|ref|YP_005285974.1| from Rickettsia rickettsii str. Colombia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378721087|ref|YP_005285974.1|
Domain Number 1 Region: 153-440
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 2.22e-50
Family Tricorn protease N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 28-160
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 2.62e-33
Family TolB, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378721087|ref|YP_005285974.1|
Sequence length 444
Comment translocation protein TolB [Rickettsia rickettsii str. Colombia]
Sequence
MRNIIYFILSLLFSVTSYALETINIEHGRADPTPIAVNKFYADNSAADVLGHDMVKVISN
DLKLSGLFRPISAASFIEEKTGIEYKPLFAAWRQINASLLVNGEVKKLESGKFQISFILW
DTLLEKQLVGEILEVPKNLWRRAAHKIADKIYEKITGDAGYFDTKIVYVSESSSLPKIKR
IALMDYDGANNKYLTNGKSLVLTPRFARSADKIFYVSYATKRRVLVYEKDLKTGKESVVG
DFPGISFAPRFSPDGRKAVMSIAKNGSTHIYEIDLATKRLHKLTDGFGINTSPSYSPDGT
KIVYNSDRNGVPQLYIMNSDGSDVQRISFGGGSYAAPSWSPRGDYIAFTKITKGDGGKTF
NIGIMKACPQDNKNSERIITSGYLVESPCWSPNGRVIMFAKGWPSSSKAPGKNKIFAIDL
TGHNEREIMTPADASDPEWSGVLN
Download sequence
Identical sequences A8GRJ1
gi|379016650|ref|YP_005292885.1| gi|157828282|ref|YP_001494524.1| WP_012150614.1.17801 WP_012150614.1.4490 WP_012150614.1.78650 WP_012150614.1.83836 392021.A1G_02315 gi|378721087|ref|YP_005285974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]