SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218550362|ref|YP_002384153.1| from Escherichia fergusonii ATCC 35469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218550362|ref|YP_002384153.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.3e-108
Family FMN-linked oxidoreductases 0.0000000000166
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.24e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000000364
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.39e-27
Family C-terminal domain of adrenodoxin reductase-like 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218550362|ref|YP_002384153.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia fergusonii ATCC 35469]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDATGVGMAGGAMLNDASQIPHHRTITEAVHLEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHQEIVQLIDSFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
NDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVENGSTFAETIELAQAIEA
AGATIINTGIGWHEARIPTIATAVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQAGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPIIPAVQIKTLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRIPPIDGIDHPK
VLNYLDVLRDKAPTGKKVAIIGCGGIGFDTAMYLSQPGESTSQNVAEFCSEWGIDSSLQQ
AGGLSPQGVQIPRSPRQIMMLQRKTSKPGQGLGKTTGWIHRTTLLSRGVKMLPGVSYQKI
DDDGLHVMINGESQLLAVDHVVICAGQEPNRALAQPLIDAGKTVHLIGGCDVAMELDARR
AIAQGTKLALEI
Download sequence
Identical sequences B7LQI7
gi|218550362|ref|YP_002384153.1| WP_000121398.1.80724 585054.EFER_3054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]