SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218550971|ref|YP_002384762.1| from Escherichia fergusonii ATCC 35469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218550971|ref|YP_002384762.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.09e-40
Family Frataxin-like 0.000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218550971|ref|YP_002384762.1|
Sequence length 106
Comment frataxin-like protein [Escherichia fergusonii ATCC 35469]
Sequence
MNDSEFHRLADTLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
Download sequence
Identical sequences A0A062Y5K6 A0A2K3TNR6 B7LU51 F0JWA8
585054.EFER_3697 gi|218550971|ref|YP_002384762.1| WP_000999963.1.31509 WP_000999963.1.42880 WP_000999963.1.5512 WP_000999963.1.80724 WP_000999963.1.93768 WP_000999963.1.97160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]